Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2omwA_

Fold library idPDB HeaderMoleculeTitle
c2omwA_PDB header: cell invasion/cell adhesionChain: A: PDB Molecule: internalin-a;PDBTitle: crystal structure of inla s192n y369s/mec1 complex


Added to library: Tue Mar 16 12:11:25 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ATITQDTPINQIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGVEYLNNLTQINF
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)


SS
S
STT
S
TTS
TT


TTS




TTGGG
TT


 .........80.........90.........100.........110.........120.........130.........140
Sequence SNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNT
Predicted secondary structure































































SS confidence





































































Known secondary structure (DSSP)
SS




GGGTT
TT



SS




GGGTT
TT
S

SS




GGGTT
TT
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence ISDISALSGLTSLQQLNFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDIT
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)


GGGTT
TT
SS



GGGTT
TT


TTS




GGGGG
TT
S

SS




G
 .........220.........230.........240.........250.........260.........270.........280
Sequence PLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAG
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) GGGG
TT


TTS




GGGGG
TT
S

SS




GGGTT
TT
S

SS




GGGTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence LTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFSNNKVSDVSSLANLTNI
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
TT
S

SS




GGGGG
TT
S

SS




GGGTT
TT
S

SS




GGGGG
TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence NWLSAGHNQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANVSIPNTVKNVTGALIAPATISDGGSYTE
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP)


SS


B
GGGTT
TT









S


B
TTS
B


SSTT
T
 .........430.........440.........450.........460.
Sequence PDITWNLPSYTNEVSYTFSQPVTIGKGTTTFSGTVTQPLKA
Predicted secondary structure

























SS confidence








































Known secondary structure (DSSP) T
SS

STT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D