Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2nbiA_

Fold library idPDB HeaderMoleculeTitle
c2nbiA_UNKPDB header: structural proteinChain: A: PDB Molecule: hep200 protein;


Added to library: Thu Feb 9 21:39:49 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QPSDLNPSSQPSECADVLEECPIDECFLPYSDASRPPSCLSFGRPDCDVLPTPQNINCPRCCATECRPDN
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)

SSSS
S

TTSSSS
S

S
TTSSSSS
S

STTTT
SSTT
SS


SSS
SS



SSSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence PMFTPSPDGSPPICSPTMLPTNQPTPPEPSSAPSDCGEVIEECPLDTCFLPTSDPARPPDCTAVGRPDCD
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)


S

TTS



SSTTSSS






S
S

S
SSSSSSS
S
TTTTTS
TTSS

S

GGGTT
SGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence VLPFPNNLGCPACCPFECSPDNPMFTPSPDGSPPNCSPTMLPTPQPSTPTVITSPAPSSQPSQCAEVIEQ
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) SSS


SSS
SS




SSSS





STTSS


SSTT
S


SSS

SS

S
S
SSSTTSSSSSS

 .........220.........230.........240.........250.........260.........270.........280
Sequence CPIDECFLPYGDSSRPLDCTDPAVNRPDCDVLPTPQNINCPACCAFECRPDNPMFTPSPDGSPPICSPTM
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) S

TTTSSSTT
S




STTTTSS
GGGGSSS

SSSS
SS


S

TTTSS



STT




SSTTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence MPSPEPSSQPSDCGEVIEECPIDACFLPKSDSARPPDCTAVGRPDCNVLPFPNNIGCPSCCPFECSPDNP
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) S


S




SSSSSTTT
SSS
TTTTT
S

GGGTT
GGGGSSS


SSS
SS




SSSS
S
 .........360.........370.........380.........390.........400.........410.........420
Sequence MFTPSPDGSPPNCSPTMLPSPSPSAVTVPLTPAPSSAPTRQPSSQPTGPQPSSQPSECADVLELCPYDTC
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)



STTTS


SSTT
S


S
SS


SSS




S









S


S

TTSSSS

SSS
SSTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence FLPFDDSSRPPDCTDPSVNRPDCDKLSTAIDFTCPTCCPTQCRPDNPMFSPSPDGSPPVCSPTMMPSPLP
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TS
SSSS

S

TTTTTSS
TT

S

SSS




SS




SSS


SS

TTS

TTSSTTS



S
 ....
Sequence SPTE
Predicted secondary structure



SS confidence



Known secondary structure (DSSP)




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D