Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2mjnA_

Fold library idPDB HeaderMoleculeTitle
c2mjnA_PDB header: rna binding proteinChain: A: PDB Molecule: nucleolysin tia-1 isoform p40;PDBTitle: structure, dynamics and rna binding of the multi-domain splicing2 factor tia-1


Added to library: Sat Apr 12 09:09:35 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GAMANHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGG
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

TTT
S

TT

TTTS

TTT

SSTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence QWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQ
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP)
TT
SS








S
S


S

TTS
TT




SS

TTTS
 .........150.........160.........170.........180......
Sequence IMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGK
Predicted secondary structure


















SS confidence













































Known secondary structure (DSSP) TTTTSSTT
TT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D