Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2m74A_

Fold library idPDB HeaderMoleculeTitle
c2m74A_PDB header: structural proteinChain: A: PDB Molecule: fibrillin-1;PDBTitle: 1h, 13c and 15n assignments of the four n-terminal domains of human2 fibrillin-1


Added to library: Sat Sep 28 08:33:52 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SARGGGGHDALKGPNVCGSRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQIAPSCG
Predicted secondary structure




























































SS confidence





































































Known secondary structure (DSSP)






SSS
BSS
S
STT

TT

TT

B



SS

TTSTT
TTS
SS
S
 .........80.........90.........100.........110.........120.........130......
Sequence SRSIQHCNIRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCE
Predicted secondary structure


















































SS confidence

































































Known secondary structure (DSSP) S


STTTS


SS

SS


TTTTTT


SS

SSS
TT
TT


SSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D