Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2m6rA_

Fold library idPDB HeaderMoleculeTitle
c2m6rA_PDB header: electron transportChain: A: PDB Molecule: flavodoxin;PDBTitle: apo_yqca


Added to library: Sat Apr 12 08:20:21 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MAEIGIFVGTMYGNSLLVAEEAEAILTAQGHKATVFEDPELSDWLPYQDKYVLVVTSTTGQGDLPDSIVP
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


S

SS

T
SS

GGGTTS


TTT


TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LFQGIKDSLGFQPNLRYGVIALGDSSYVNFCNGGKQFDALLQEQSAQRVGEMLLIDASENPEPETESNPW
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T
S
SS

TTSTTTTT



S

TTT
S
T
 .........
Sequence VEHWGTLLS
Predicted secondary structure
SS confidence








Known secondary structure (DSSP) GGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D