Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2la6A_

Fold library idPDB HeaderMoleculeTitle
c2la6A_PDB header: rna binding proteinChain: A: PDB Molecule: rna-binding protein fus;PDBTitle: solution nmr structure of rrm domain of rna-binding protein fus from2 homo sapiens, northeast structural genomics consortium target hr6430a


Added to library: Sat May 7 09:19:54 2011
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MGHHHHHHSHSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSF
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

SS
S

S



S


SS

TTTS
B
TTTTS
TTT
SB
 .........80.........90.........
Sequence DDPPSAKAAIDWFDGKEFSGNPIKVSFAT
Predicted secondary structure








SS confidence




























Known secondary structure (DSSP) SSTT
BSSSSB



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D