Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2kulA_

Fold library idPDB HeaderMoleculeTitle
c2kulA_PDB header: transferaseChain: A: PDB Molecule: serine/threonine-protein kinase vrk1;PDBTitle: solution structure of human vaccinia related kinase 1(vrk1)


Added to library: Thu Jan 10 01:08:30 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVV
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)




















SSSTT

TTS



SSSSS




SS


SSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence KVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQK
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TT
SS

TT










TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence IYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVH
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTT


TTTB

S


GGGTT

GGG

BSSSTT

 .........220.........230.........240.........250.........260.........270.........280
Sequence KEYKEDPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRE
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

S


SS


SS
TTTST



SS
TTTTTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence NIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTTS
SS


TTTTSS

TT
SSTTS
S









 .........360
Sequence AKTITKKRKK
Predicted secondary structure






SS confidence









Known secondary structure (DSSP)




SS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D