Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2kr0A_

Fold library idPDB HeaderMoleculeTitle
c2kr0A_PDB header: protein bindingChain: A: PDB Molecule: proteasomal ubiquitin receptor adrm1;PDBTitle: a proteasome protein


Added to library: Sat Aug 28 18:00:46 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVE
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

S
S


TTS




SS

S
S
SSSS

S

TTS
SSS

 .........80.........90.........100.........110.........120.........130.........140
Sequence DDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALGAS
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
TTS
TT
SSS
TTT



S
GGGS
S

S
S


 .........150.........160.........170.........180.........190.........200.........210
Sequence GSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGLGGLGALTGPGLASLLGSSGPPGSSSSSSSR
Predicted secondary structure





























































SS confidence





































































Known secondary structure (DSSP) SS



SS


S


S
S
SS


S

SS



SS


STT
S





STTTTT
S



SSS



S
 .........220.........230.........240.........250.........260.........270.........280
Sequence SQSAAVTPSSTTSSTRATPAPSAPAAASATSPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNVPAGP
Predicted secondary structure




























































SS confidence





































































Known secondary structure (DSSP)






TTS





S






SS


SS



S

SSSSSTTTS



SSTSSS
T
 .........290.........300.........310.........320.........330.........340.........350
Sequence AGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASG
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T
SGGGTS
TSGGG

SS




STTS

ST
 .........360.........370.........380.........390.........400.......
Sequence QLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD
Predicted secondary structure





























SS confidence
























































Known secondary structure (DSSP) SSTT

T
T
SSS

S
S








SS



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D