Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2ifgB_

Fold library idPDB HeaderMoleculeTitle
c2ifgB_PDB header: transferaseChain: B: PDB Molecule: high affinity nerve growth factor receptor;PDBTitle: structure of the extracellular segment of human trka in2 complex with nerve growth factor


Added to library: Tue Mar 16 13:45:00 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRF
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)

SSS

SSSS

SS


TTTTTS
S
S

S



S



GGGG
S



S

SS


 .........80.........90.........100.........110.........120.........130.........140
Sequence VAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
TTGGGS
S




SS

S
GGGTSS





SS




GGGTT
SS
GGG

 .........150.........160.........170.........180.........190.........200.........210
Sequence QCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLP
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) B
SSSS
BS



TT





SS

BSS


SS

B

S


SS




SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence SLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRW
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S

GGGSS



B
SS







B


SSSS

 .........290.........300.........310.........320.........330.........340.......
Sequence LFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNP
Predicted secondary structure





















SS confidence


































































Known secondary structure (DSSP) TT



SS



TT


SS

GGG
TT

S



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D