Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2id5D_

Fold library idPDB HeaderMoleculeTitle
c2id5D_PDB header: ligand binding protein,membrane proteinChain: D: PDB Molecule: leucine rich repeat neuronal 6a;PDBTitle: crystal structure of the lingo-1 ectodomain


Added to library: Tue Mar 16 12:56:22 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CPPRCECSAQDRAVLCHRKRFVAVPEGIPRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGA
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)

SSSTTTT

SS

SS

SS





S




TTTTTT



S

TT




SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence FNNLFNLRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISH
Predicted secondary structure





























































SS confidence





































































Known secondary structure (DSSP) STT
TT


TTS

S


TTTTTT
TT



SS



TTTTTT
TT



TT


T
 .........150.........160.........170.........180.........190.........200.........210
Sequence RAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYSFKRLYRLKVLEISHWPYLDT
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TTTTT
TT

S


SS

TT
TT

S




TT
S
S
TT



TT

 .........220.........230.........240.........250.........260.........270.........280
Sequence MTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPISTIEGSMLHELLRLQEIQLVGGQLA
Predicted secondary structure






























































SS confidence





































































Known secondary structure (DSSP)
TTTTTT


SSS

SS

TTTTTT
TT



SS



TTSSTT
TT



SS

S
 .........290.........300.........310.........320.........330.........340.........350
Sequence VVEPYAFRGLNYLRVLNVSGNQLTTLEESVFHSVGNLETLILDSNPLACDCRLLWVFRRRWRLNFNRQQP
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
TTTTTT
TT


TTS

S


GGG
S
GGG



SS

SGGGTTTTTTT
TT


 .........360.........370.........380.........390.........400.........410.........420
Sequence TCATPEFVQGKEFKDFPDVLLPNYFTCRRARIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILWLSPRKH
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) BSGGGTT
BGGGS
SS

TTTT

S

S

TT




S


TTS
 .........430.........440.........450.........460.........470.
Sequence LVSAKSNGRLTVFPDGTLEVRYAQVQDNGTYLCIAANAGGNDSMPAHLHVR
Predicted secondary structure
















SS confidence


















































Known secondary structure (DSSP)
SS

SS
TTS
SS

GGG
TT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D