Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2higA_

Fold library idPDB HeaderMoleculeTitle
c2higA_PDB header: transferaseChain: A: PDB Molecule: 6-phospho-1-fructokinase;PDBTitle: crystal structure of phosphofructokinase apoenzyme from2 trypanosoma brucei.


Added to library: Tue Mar 16 13:58:11 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VTSKLVKAHRAMLNSVTQEDLKVDRLPGADYPNPSKKYSSRTEFRDKTDYIMYNPRPRDNPVSVSPLLCE
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)


TT
S
SS

TTTT


S



TT

GGGGGGSBSS

S


B




BS


 .........80.........90.........100.........110.........120.........130.........140
Sequence LAAARSRIHFNPTETTIGIVTCGGICPGLNDVIRSITLTGINVYNVKRVIGFRFGYWGLSKKGSQTAIEL
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)


BSSS
GGG

SS

TT

S
STGGGGGSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence HRGRVTNIHHYGGTILGSSRGPQDPKEMVDTLERLGVNILFTVGGDGTQRGALVISQEAKRRGVDISVFG
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
TTGGGSSS
SS



S


T
S
T


 .........220.........230.........240.........250.........260.........270.........280
Sequence VPKTIDNDLSFSHRTFGFQTAVEKAVQAIRAAYAEAVSANYGVGVVKLMGRDSGFIAAQAAVASAQANIC
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

TTSS


SS

TTTSTT

SS

T

S
 .........290.........300.........310.........320.........330.........340.........350
Sequence LVPENPISEQEVMSLLERRFCHSRSCVIIVAEGFGQDWGRGGYDASGNKKLIDIGVILTEKVKAFLKANK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
TTS


TTS
STTTTGGG



B
TTS
B



TTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence SRYPDSTVKYIDPSYMIRACPPSANDALFCATLATLAVHEAMAGATGCIIAMRHNNYILVPIKVATSVRR
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTSSS


SS


TTSTTTT
 .........430.........440
Sequence VLDLRGQLWRQVREITVDLG
Predicted secondary structure








SS confidence



















Known secondary structure (DSSP)
TTSS




Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D