Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2h9xA_

Fold library idPDB HeaderMoleculeTitle
c2h9xA_PDB header: toxinChain: A: PDB Molecule: toxin cgna;PDBTitle: nmr structure for the cgna toxin from the sea anemone2 condylactis gigantea


Added to library: Wed Jan 9 16:06:39 2013
 
Links to external resources


 1........10.........20.........30.........40......
Sequence GVCRCDSDGPSVHGNTLSGTVWVGSCASGWHKCNDEYNIAYECCKQ
Predicted secondary structure

















SS confidence













































Known secondary structure (DSSP)




TT

TTSTT
SS
SSSS

TT
B
SSS


SSSB


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D