Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2h8hA_

Fold library idPDB HeaderMoleculeTitle
c2h8hA_PDB header: transferaseChain: A: PDB Molecule: proto-oncogene tyrosine-protein kinase src;PDBTitle: src kinase in complex with a quinazoline inhibitor


Added to library: Tue Mar 16 14:11:30 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKIT
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)
SS
B


SSSB

B
TT

SSSSTTT

GGGTTSGGGSTTB

S

 .........80.........90.........100.........110.........120.........130.........140
Sequence RRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQ
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) T
TT

TT
SSSTT
TTTB
-

S
TTSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence QLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAI
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

TTSSS










SSSSTT
SB

GGG
SSTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence KTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLV
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TTSS



TTB


SSS



TTSTT

 .........290.........300.........310.........320.........330.........340.........350
Sequence DMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAA
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TT


S

SGGG
GGG


TTSTTT


TT
STTS
GGGS
 .........360.........370.........380.........390.........400.........410.........420
Sequence LYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)



TTTT

SSTT

TT





TT

T
SSGG
 .........430.........440....
Sequence ERPTFEYLQAFLEDYFTSTEPQQP
Predicted secondary structure









SS confidence























Known secondary structure (DSSP) GS

TSS


S




Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D