Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2goiC_

Fold library idPDB HeaderMoleculeTitle
c2goiC_PDB header: cell adhesion, sugar binding proteinChain: C: PDB Molecule: sperm lysozyme-like protein 1;PDBTitle: crystal structure of mouse sperm c-type lysozyme-like2 protein 1


Added to library: Tue Mar 16 13:03:06 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AKVFSRCELAKEMHDFGLDGYRGYNLADWVCLAYYTSGFNTNAVDHEADGSTNNGIFQISSRRWCRTLAS
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)

B

TT
TTGGG

TTBTT

TTS
TTTTTTTTSB
SSS
 .........80.........90.........100.........110.........120........
Sequence NGPNLCRIYCTDLLNNDLKDSIVCAMKIVQEPLGLGYWEAWRHHCQGRDLSDWVDGCD
Predicted secondary structure


























SS confidence

























































Known secondary structure (DSSP)



TT
SBGGGGG
SS
TSTTGGGG
TTTS

GGGTTT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D