Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2fugC_

Fold library idPDB HeaderMoleculeTitle
c2fugC_PDB header: oxidoreductaseChain: C: PDB Molecule: nadh-quinone oxidoreductase chain 3;PDBTitle: crystal structure of the hydrophilic domain of respiratory2 complex i from thermus thermophilus


Added to library: Tue Mar 16 13:30:36 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLIQWQPKLAASCVTAVA
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

SS

TT
BT





S

TTS


S
STTS


B
SS
TTT
B

 .........80.........90.........100.........110.........120.........130.........140
Sequence DGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKLPVYTRFEFTRRHVDK
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TT
S

T



TTT
TTGGG
T







S



S






 .........150.........160.........170.........180.........190.........200.........210
Sequence HHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALL
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
SSSSS

S





TT






BS
GGG
B


SSTT

SS

T
SSSSSB
 .........220.........230.........240.........250.........260.........270.........280
Sequence DLTARFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
GGGSSS

TTTS


SSTT


TT


TTSS
S


TTSS

 .........290.........300.........310.........320.........330.........340.........350
Sequence KTPLVRKEGRLVEATWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
S

SSS

TTSSSSS

TT

SSS

TT

S
 .........360.........370.........380.........390.........400.........410.........420
Sequence APASLFPPASLEDLLQADFALVLGDPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTD
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) S
TTSS
B


S
S
STTT





BTTBS
S

TT

SS



GG
 .........430.........440.........450.........460.........470.........480.........490
Sequence KMALFAPYRAPLMKWAAIHEVHRPGEEREILLALLGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTV
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) GSS

GGGTT
S

TT
TSS



SS

SGGG
 .........500.........510.........520.........530.........540.........550.........560
Sequence AAERARLLAERAKVLAMTPAANARGLEAMGVLPGAKGASWDEPGALYAYYGFVPPEEALKGKRFVVMHLS
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)



SSTTTTT
S

SSS

SS



SSSS


TT
S


S
 .........570.........580.........590.........600.........610.........620.........630
Sequence HLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQVLALLAEALGVRPPFRLHL
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) S

TT
S




GGG


TTSB











S


S
SS
 .........640.........650.........660.........670.........680.........690.........700
Sequence EAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAWAHPETARAEALPE
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) TT


SS
B














S



SS
GGG
STTS




SSS
STTT

T
 .........710.........720.........730.......
Sequence GAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAA
Predicted secondary structure


















SS confidence




































Known secondary structure (DSSP) T
TTS
SS



SS









Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D