Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2ft3B_

Fold library idPDB HeaderMoleculeTitle
c2ft3B_PDB header: structural protein, signaling proteinChain: B: PDB Molecule: biglycan;PDBTitle: crystal structure of the biglycan dimer core protein


Added to library: Tue Mar 16 13:19:07 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AMCPFGCHCHLRVVQCSDLGLKAVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIH
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)



SS
TT

SS

SSS
S


TT



SS



TTTTTT
TT



SS



 .........80.........90.........100.........110.........120.........130.........140
Sequence EKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGF
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) GGGSTT
TT



SS


S

SS

TT



S






STTSSS
SS



SS


GGGS
 .........150.........160.........170.........180.........190.........200.........210
Sequence EPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIEN
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
TTSS
S


S

B

SS

SS

SSS
TT
S

B

SS





TTTTTT
TT
S

SS





T
 .........220.........230.........240.........250.........260.........270.........280
Sequence GSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHTNNITKVGVNDFCPVGFGVKRAYYNGISLFNN
Predicted secondary structure



























































SS confidence





































































Known secondary structure (DSSP) TGGGS
TT



SS


B

TTGGG
TT


TTS


B

TTSSS
TT

SS



S

SS
 .........290.........300...
Sequence PVPYWEVQPATFRCVTDRLAIQF
Predicted secondary structure














SS confidence






















Known secondary structure (DSSP) SS
GGGS
GGGGSS

SSTT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D