Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2fo0A_

Fold library idPDB HeaderMoleculeTitle
c2fo0A_PDB header: transferaseChain: A: PDB Molecule: proto-oncogene tyrosine-protein kinase abl1 (1bPDBTitle: organization of the sh3-sh2 unit in active and inactive2 forms of the c-abl tyrosine kinase


Added to library: Tue Mar 16 12:44:35 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ARWNKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYI
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)




TTTT

GGGS
TTSS
B


STTB

B
TT

TTSSTTGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence TPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYV
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TTSGGGSTT

TSSS
TT
SSSTT
TT
TTS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence SSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEV
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) STT

BSS

TTSSS











SSS
SSTT

B

GGGSGGGTTSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence YEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDY
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) GGGT

TTS




TTB


SSSS


TT
B
 .........290.........300.........310.........320.........330.........340.........350
Sequence LRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRNLAARNCLVGENHLVKVADFGLSRLMTGDTYTAH
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S
TTTS
TT
S

SGGG
GGG


TT


SS



 .........360.........370.........380.........390.........400.........410.........420
Sequence AGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPE
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TT



GGG



TTS

SSTT

TT





TT

 .........430.........440.........450.........460.....
Sequence KVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELG
Predicted secondary structure











SS confidence












































Known secondary structure (DSSP) T
SSGGGS

TSSSSS


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D