Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2f37B_

Fold library idPDB HeaderMoleculeTitle
c2f37B_PDB header: membrane proteinChain: B: PDB Molecule: transient receptor potential cation channelPDBTitle: crystal structure of the ankyrin repeat domain of human2 trpv2


Added to library: Tue Mar 16 14:40:23 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDSEYTEGSTGKTCLXKAVLNLKDGVNACILPLL
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

S


T
GGGGTTT

TTSGGGSBTTTTB
T
BTTB
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence QIDRDSGNPQPLVNAQCTDDYYRGHSALHIAIEKRSLQCVKLLVENGANVHARACGRFFQKGQGTCFYFG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) T
SS
GGG
B

STTTTT
BTT
TT

TT



SGGG
TTSSSS

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence ELPLSLAACTKQWDVVSYLLENPHQPASLQATDSQGNTVLHALVXISDNSAENIALVTSXYDGLLQAGAR
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) SSTT

SS



TT


TTS



S
 .........220.........230.........240.........
Sequence LCPTVQLEDIRNLQDLTPLKLAAKEGKIEIFRHILQREF
Predicted secondary structure


















SS confidence






































Known secondary structure (DSSP) STT

GGG


TTS

TT
T


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D