Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2eyzA_

Fold library idPDB HeaderMoleculeTitle
c2eyzA_PDB header: signaling proteinChain: A: PDB Molecule: v-crk sarcoma virus ct10 oncogene homologPDBTitle: ct10-regulated kinase isoform ii


Added to library: Tue Mar 16 14:08:45 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPP
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)

SS


SSSSSS





SSTTTT

SS


S

SSSS


SSSS




SS

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence VPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRAL
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP) S






SSSSS




BTTB

S
TTTTTS

SSSSS

B

S
S

S










 .........150.........160.........170.........180.........190.........200.........210
Sequence FDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHP
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP) S



S
SSS



TT


SSS
TTS
STT


STTS






SS

S

 .........220.........230.........240.........250.........260.........270.........280
Sequence QPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECN
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)
S
S


SBTTB
SSSS
SSS

SS



S

SS
B


TT
SS


B
TTS


TTS
T
 .........290.........300....
Sequence GKRGHFPFTHVRLLDQQNPEEDFS
Predicted secondary structure









SS confidence























Known secondary structure (DSSP) T


TTS


SS

TT




Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D