Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
  Protein Homology/analogY Recognition Engine V 2.2
 

Fold library entry viewer: c2elnA_

Fold library idPDB HeaderMoleculeTitle
c2elnA_PDB header: transcriptionChain: A: PDB Molecule: zinc finger protein 406;PDBTitle: solution structure of the 11th c2h2 zinc finger of human2 zinc finger protein 406


Added to library: Tue Mar 16 13:46:08 2010
 
Links to external resources


 1........10.........20.........30........
Sequence GSSGSSGILLKCPTDGCDYSTPDKYKLQAHLKVHTALD
Predicted secondary structure






















SS confidence





































Known secondary structure (DSSP)


SS




SSSS


S
S



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: Phyre2.2: A Community Resource for Template-based Protein Structure Prediction
Powell HR et al. Journal of Molecular Biology (2025) in press DOI: https://doi.org/10.1016/j.jmb.2025.168960
 
© Structural Bioinformatics Group, Imperial College, London
Michael Sternberg  
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D