Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2d6fA_

Fold library idPDB HeaderMoleculeTitle
c2d6fA_PDB header: ligase/rnaChain: A: PDB Molecule: glutamyl-trna(gln) amidotransferase subunit d;PDBTitle: crystal structure of glu-trna(gln) amidotransferase in the2 complex with trna(gln)


Added to library: Tue Mar 16 12:17:29 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SYQGRARKFLESASIDVGDMVLVEKPDVTYEGMVLDRADDADDRHIVLKLENGYNIGVEISDARIELLEK
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


TTT

TT

SS




TTS
SS
TTS

TT




 .........80.........90.........100.........110.........120.........130.........140
Sequence GSAAEDPELPDVSIISTGGTVASIIDYRTGAVHPAFTADDLLRANPELLDIANIRGRAVFNILSENMKPE
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)





SSS
SS





TTTS




TT
GGGGGT








GGG

 .........150.........160.........170.........180.........190.........200.........210
Sequence YWVETARAVYGEIKDGADGVVVAHGTDTMHYTSAALSFMLRTPVPVVFTGAQRSSDRPSSDASLNIQCSV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT
S

TTT
SS


SS
TTSTT
T
 .........220.........230.........240.........250.........260.........270.........280
Sequence RAATSEIAEVTVCMHATMDDLSCHLHRGVKVRKMHTSRRDTFRSMNALPLAEVTPDGIKILEENYRKRGS
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) SS

SSSSSSS
GGG
SSS
TT
SSS

STT








STT
 .........290.........300.........310.........320.........330.........340.........350
Sequence DELELSDRVEERVAFIKSYPGISPDIIKWHLDEGYRGIVIEGTGLGHCPDTLIPVIGEAHDMGVPVAMTS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S










TT

TT
SBTTTB

GGGTT

 .........360.........370.........380.........390.........400.........410.........420
Sequence QCLNGRVNMNVYSTGRRLLQAGVIPCDDMLPEVAYVKMCWVLGQTDDPEMAREMMRENIAGEINERTSIA
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TT
SS


TTSSTT

TT

TTT


S
SSS


SS

GG
 ....
Sequence YFRG
Predicted secondary structure


SS confidence



Known secondary structure (DSSP) G



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D