Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2crwA_

Fold library idPDB HeaderMoleculeTitle
c2crwA_PDB header: signaling proteinChain: A: PDB Molecule: adp-ribosylation factor gtpase-activatingPDBTitle: solution structure of the arfgap domain of adp-ribosylation2 factor gtpaseactivating protein 3 (arfgap 3)


Added to library: Wed Jan 9 16:51:51 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GSSGSSGMGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLSFIR
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)






S



STTTSB
SSS

BS


TTTT


TTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence STELDSNWSWFQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSLASQATRKHGTDLW
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
SSS




TT






TTSTTSSS
T
 .........
Sequence LDSSGPSSG
Predicted secondary structure







SS confidence








Known secondary structure (DSSP) TS







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D