Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2crwA_

Fold library idPDB HeaderMoleculeTitle
c2crwA_PDB header: signaling proteinChain: A: PDB Molecule: adp-ribosylation factor gtpase-activatingPDBTitle: solution structure of the arfgap domain of adp-ribosylation2 factor gtpaseactivating protein 3 (arfgap 3)


Added to library: Wed Jan 9 16:51:51 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GSSGSSGMGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLSFIR
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)






S



STTTSB
SSS

BS


TTTT


TTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence STELDSNWSWFQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSLASQATRKHGTDLW
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
SSS




TT






TTSTTSSS
T
 .........
Sequence LDSSGPSSG
Predicted secondary structure







SS confidence








Known secondary structure (DSSP) TS







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D