Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2c0iA_

Fold library idPDB HeaderMoleculeTitle
c2c0iA_PDB header: transferaseChain: A: PDB Molecule: tyrosine-protein kinase hck;PDBTitle: src family kinase hck with bound inhibitor a-420983


Added to library: Tue Mar 16 12:10:57 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEEWFFKGI
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

SS
B


SSSB

B
TT
TTTTT

GGGTTSGGGSTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence SRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTL
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
TSTT

TT

SSSTT
TTTB

STT
SSTTSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence QELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAV
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TTSS
SS
SS


SB










TT
SB

GGGTTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence KTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLI
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


SS
T


TTB


SSS


TT
BSTTGGG

 .........290.........300.........310.........320.........330.........340.........350
Sequence DFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIPIKWTAPEAINFGSFTIKSDVWS
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT


S

SGGG
TT



TTGGGT

GGGS




 .........360.........370.........380.........390.........400.........410.........420
Sequence FGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYNIMMRCWKNRPEERPTFEYIQSVLD
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTT

SSTT

TT





TT

T
SSGGGS

 .........430...
Sequence DFYTATESQEEIP
Predicted secondary structure







SS confidence












Known secondary structure (DSSP) TTTS
GGG





Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D