Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2ajaA_

Fold library idPDB HeaderMoleculeTitle
c2ajaA_PDB header: protein bindingChain: A: PDB Molecule: ankyrin repeat family protein;PDBTitle: x-ray structure of an ankyrin repeat family protein q5zsv02 from legionella pneumophila. northeast structural genomics3 consortium target lgr21.


Added to library: Tue Mar 16 13:10:52 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NLTIHNIENYENDPQLRLIPWILWENLFQHFISANELSLXTLSYKEAIHIFLPGTKNXEQVRQLLCLYYA
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)



GGGTTTSTTGGGS
TSTT
S




SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence HYNRNAKQLWSDAHKKGIKSEVICFVAAITGCSSALDTLCLLSDEIVKQAENYQAFRLAAENGHLHVLNR
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTTT
TTT



TT


SS


TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LCELAPTEIXAXIQAENYHAFRLAAENGHLHVLNRLCELAPTEATAXIQAENYYAFRWAAVGRGHHNVIN
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S
TTTSTT
S
GGGSTT

 .........220.........230.........240.........250.........260.........270.........280
Sequence FLLDCPVXLAYAEIHEFEYGEKYVNPFIARHVNRLKEXHDAFKLSNPDGVFDLVTKSECLQGFYXLRNLI
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTS
TTTTTTTTTTTTTTSSSS



SS
 .........290.........300.........310.........320.........330.........340...
Sequence RRNDEVLLDDIRFLLSIPGIKALAPTATIPGDANELLRLALRLGNQGACALLLSIPSVLALTK
Predicted secondary structure


















SS confidence






























































Known secondary structure (DSSP)

GGGTSTTTGGGSS

SSTT


T
TTTTSS


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D