Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2a0zA_

Fold library idPDB HeaderMoleculeTitle
c2a0zA_PDB header: immune systemChain: A: PDB Molecule: toll-like receptor 3;PDBTitle: the molecular structure of toll-like receptor 3 ligand2 binding domain


Added to library: Tue Mar 16 13:43:28 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELC
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)


TT

SS

SS

SSS
TT
S

SS





GGGGTT
TT
S

SS





TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence QKLPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLG
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)
TT



SS





TTTTTT
TT
S
TTS





S
TTTT
TT



SS







 .........150.........160.........170.........180.........190.........200.........210
Sequence TQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGP
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) SSS

TT



SS



B
GGGTGGGTT
S

S




B
TTTTTTSS

TT



 .........220.........230.........240.........250.........260.........270.........280
Sequence SLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQLEYFFL
Predicted secondary structure

































































SS confidence





































































Known secondary structure (DSSP) TTTS



TTS



TTTTGGGGGS



TTS



TTTTTT
TT


 .........290.........300.........310.........320.........330.........340.........350
Sequence EYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEHLNMEDNDIPGIKSNMF
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
S

B

TTTTTT
TT


TT
B



SSS




TTTTTT
TT



S

B



TTSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence TGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKIESDAFSWLGHLEVLDLGLNEIGQ
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TT
TT


TT
BS



SSTTGGGTTS




SS



TTTTTT
TT



SS

 .........430.........440.........450.........460.........470.........480.........490
Sequence ELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVPSLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSN
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)

SGGGTT
TT



S
S

TTTTTT
TT



SS

B
TT
SS
TTTT
TT



S
 .........500.........510.........520.........530.........540.........550.........560
Sequence NNIANINDDMLEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDL
Predicted secondary structure




























































SS confidence





































































Known secondary structure (DSSP) S





TTTTTT
TT



SS

GGGGSTTSTT



TTTT
TT



SS





TTTTTT
 .........570.........580.........590.........600.........610.........620.........630
Sequence FELKIIDLGLNNLNTLPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIA
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) TT



SS





TTTTTT
TT


TTS





TT
S

S


S
 .........640.........650.........660.........670.
Sequence WFVNWINETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSC
Predicted secondary structure






















SS confidence








































Known secondary structure (DSSP)

SB
TT
BSTTSTT
BGGG


TT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D