Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1zq1B_

Fold library idPDB HeaderMoleculeTitle
c1zq1B_PDB header: lyaseChain: B: PDB Molecule: glutamyl-trna(gln) amidotransferase subunit d;PDBTitle: structure of gatde trna-dependent amidotransferase from2 pyrococcus abyssi


Added to library: Tue Mar 16 13:00:05 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RVDEFLKERNINVGDFVRITKEEDGEEVTYEGYIXPPYELSAGDTLVLKLENGYNIGIALEKIRRIEVLE
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
T


TT
TT



TT

SSTTS
GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence RAKVKPEVHFEALIEGKPGLPEVTIIGTGGTIASRIDYETGAVYPAFTAEELAKALPEIFEVANVKPKLL
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)










SS



TT

SS



TTTT



GGGGGTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence FNIFSEDXKPKHWVKIAHEVAKALNSGDYGVVVAHGTDTXGYTAAALSFXLRNLGKPVVLVGAQRSSDRP
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)



GGG

T
S

TTTSBT

S


SS
TTST
 .........220.........230.........240.........250.........260.........270.........280
Sequence SSDAAXNLICSVRXATSEVAEVXVVXHGETGDTYCLAHRGTKVRKXHTSRRDAFRSINDVPIAKIWPNGE
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) T
STSSB
SSSSSSS
TTS
SSS
GGGSSS

S
TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence IEFLRKDYRKRSDEEVEVDDKIEEKVALVKVYPGISSEIIDFLVDKGYKGIVIEGTGLGHTPNDIIPSIE
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S
S
S
B

S


B









SS

TTT
S
BTTTB

TTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence RAVEEGVAVCXTSQCIYGRVNLNVYSTGRKLLKAGVIPCEDXLPETAYVKLXWVLGHTQNLEEVRKXXLT
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT


SSSSS


TTSSTT

TT

TT


TS
 .........430........
Sequence NYAGEITPYTRFDTYLRD
Predicted secondary structure










SS confidence

















Known secondary structure (DSSP)
SSSSS
SS

GGGS



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D