Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1ziwA_

Fold library idPDB HeaderMoleculeTitle
c1ziwA_PDB header: immune systemChain: A: PDB Molecule: toll-like receptor 3;PDBTitle: human toll-like receptor 3 extracellular domain structure


Added to library: Tue Mar 16 12:10:08 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLP
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)
BSS

SS

SS

S
S
TT
S

SS





GGGGGGGTT
S

SS





TT
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence MLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQ
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) T



SS





TTTTTT
TT
S

SS





S
TTTT
TT



SS

S




SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTE
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
TT



SS



B
GGGTT
S
TT




B
TTGGGGSS

TT


 .........220.........230.........240.........250.........260.........270.........280
Sequence KLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQLEYFFLEYNN
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TTS



TTS



TTTTGGGGGS



TTS



TTTTTT
TT



S

 .........290.........300.........310.........320.........330.........340.........350
Sequence IQHLFSHSLHGLFNVRYLNLKRSFTKQLPKIDDFSFQWLKCLEHLNMEDNDIPGIKSNMFTGLINLKYLS
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) BS
TTTTTT
TT


TT
B





TTTTTT
TT



S

B



TTTTTT
TT

 .........360.........370.........380.........390.........400.........410.........420
Sequence LSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGL
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
TT
BS



TTTTGGGTTS



TTS



TTTTTT
TT



SS



SGGGTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence ENIFEIYLSYNKYLQLTRNSFALVPSLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDM
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TT



S
S

TTTTTT
TT


TTS

B
TT
SS
TTTT
TT



SS





TTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence LEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGL
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) TTT
TT



SS

GGGGSTTSTTS


TTTT
TT



SS





TTTTTT
TT



S
 .........570.........580.........590.........600.........610.........620.........
Sequence NNLNTLPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNWINET
Predicted secondary structure






































SS confidence




































































Known secondary structure (DSSP) S





TTTTTT
TT


TTS


B

TT
S
TT



B




SS

SS


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D