Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1zc1A_

Fold library idPDB HeaderMoleculeTitle
c1zc1A_PDB header: protein turnoverChain: A: PDB Molecule: ubiquitin fusion degradation protein 1;PDBTitle: ufd1 exhibits the aaa-atpase fold with two distinct2 ubiquitin interaction sites


Added to library: Tue Mar 16 13:13:49 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MFSGFSSFGGGNGFVNMPQTFEEFFRCYPIAMMNDRIRKDDANFGGKIFLPPSALSKLSMLNIRYPMLFK
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)









STT




GGGS
TTTS
SS
TT

SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence LTANETGRVTHGGVLEFIAEEGRVYLPQWMMETLGIQPGSLLQISSTDVPLGQFVKLEPQSVDFLDISDP
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TTT



SS

T

TT




S

TSS
 .........150.........160.........170.........180.........190.........200........
Sequence KAVLENVLRNFSTLTVDDVIEISYNGKTFKIKILEVKPESSSKSICVIETDLVTDFAPPVGYVEPDYK
Predicted secondary structure































SS confidence



































































Known secondary structure (DSSP)
S
SSSTT
SSTT


SSS
S












Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D