Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1y57A_

Fold library idPDB HeaderMoleculeTitle
c1y57A_PDB header: transferaseChain: A: PDB Molecule: proto-oncogene tyrosine-protein kinase src;PDBTitle: structure of unphosphorylated c-src in complex with an2 inhibitor


Added to library: Tue Mar 16 13:37:51 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFG
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)
TTSS
B


SSSB

B
TT

S

SSSSTTT

GGGTTSGGGSTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence KITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFN
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) S

T
TT

TT

SSSTT
TTT
SSS
SSTTSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence SLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTR
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) S

TTSSS



B







SS



TTB

GGGTTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence VAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLP
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TTSS



TTB


SSS


TTS

 .........290.........300.........310.........320.........330.........340.........350
Sequence QLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAP
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TT
S

SGGG
GGG



TT


SS




TTTT
SGGGS
 .........360.........370.........380.........390.........400.........410.........420
Sequence EAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRK
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)



TTS

SSTT

TT





TT

T
S
 .........430.........440.........450..
Sequence EPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Predicted secondary structure














SS confidence































Known secondary structure (DSSP) SGGGS

TT
TT



S


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D