Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1xkuA_

Fold library idPDB HeaderMoleculeTitle
c1xkuA_PDB header: structural proteinChain: A: PDB Molecule: decorin;PDBTitle: crystal structure of the dimeric protein core of decorin,2 the archetypal small leucine-rich repeat proteoglycan


Added to library: Tue Mar 16 12:02:04 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GPVCPFRCQCHLRVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKI
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)




TT
TT
TTS


S


S

TT



SS



B
TTTTTT
TT



SS



B
 .........80.........90.........100.........110.........120.........130.........140
Sequence SPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSG
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
TTTTTT
TT



SS

SB

SS

TT



SS


BB
TT
TT



SS


GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence IENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAV
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) B
TTGGGG
TT



SS


S

SS

TT
S
TTS



TGGGTT
TT



SS


 .........220.........230.........240.........250.........260.........270.........280
Sequence DNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLF
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP)
TTTGGGSTT



SS

SS

TTTTT
SS



SS





TTSSS
SS

TTS


S

 .........290.........300.....
Sequence SNPVQYWEIQPSTFRCVYVRAAVQL
Predicted secondary structure

















SS confidence
























Known secondary structure (DSSP) SSSS
GGGS
GGGGTT


GGG


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D