Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1xeuA_

Fold library idPDB HeaderMoleculeTitle
c1xeuA_PDB header: cell invasionChain: A: PDB Molecule: internalin c;PDBTitle: crystal structure of internalin c from listeria2 monocytogenes


Added to library: Tue Mar 16 12:49:50 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHL
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)


SS


ST
S
TTS
TT
S
TTS




TTGGG
TT


 .........80.........90.........100.........110.........120.........130.........140
Sequence SHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSACLSRLFLDNNELRDTDSLIHLKNLEILSIRNNKL
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP)
SS




GGGTT
SS



SS

S

TT


SS



SS

SBSGGGTT
TT


TTS

 .........150.........160.........170.........180.........190.........200.........210
Sequence KSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLTGQKCVNEPVKYQPELYITNTVKDPDGRWIS
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP)
B
GGGGG
TT


TTS


B
TTSTT









S


B
TTS
B

 .........220.........230.........240.........250.........260...
Sequence PYYISNGGSYVDGCVLWELPVYTDEVSYKFSEYINVGETEAIFDGTVTQPIKN
Predicted secondary structure





























SS confidence




















































Known secondary structure (DSSP)
SGGG
TT
SS

STT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D