Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1w2wA_

Fold library idPDB HeaderMoleculeTitle
c1w2wA_PDB header: isomeraseChain: A: PDB Molecule: 5-methylthioribose-1-phosphate isomerase;PDBTitle: crystal structure of yeast ypr118w, a methylthioribose-1-2 phosphate isomerase related to regulatory eif2b subunits


Added to library: Tue Mar 16 12:03:04 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XSLEAIVFDRSEPENVSVKVLDQLLLPYTTKYVPIHTIDDGYSVIKSXQVRGAPAIAIVGSLSVLTEVQL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
TT
S
SSTTS

TTTTTT




STTSS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence IKHNPTSDVATLYSLVNWESTKTVLNKRLDFLLSSRPTAVNLSNSLVEIKNILKSSSDLKAFDGSLYNYV
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
TTSTGGGGS
TT
TS

S
ST
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence CELIDEDLANNXKXGDNGAKYLIDVLQKDGFKDEFAVLTICNTGSLATSGYGTALGVIRSLWKDSLAKTD
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT

S






S

SGGGSSSS
S
 .
Sequence K
Predicted secondary structure
SS confidence
Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D