Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1vw4a_

Fold library idPDB HeaderMoleculeTitle
c1vw4a_PDB header: ribosomeChain: A: PDB Molecule:PDBTitle: structure of the yeast mitochondrial large ribosomal subunit


Added to library: Sat Apr 12 08:19:59 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QFGFPKTQVTTIYNKTKSASNYKGYLKHRDAPGMYYQPSESIATGSVNSETIPRSFMAASDPRRGLDMPV
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP)




B




SS
TTT
SS




SS

B


SS

SS


TTTS
GGGS
TT
GGGTS

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence QSTKAKQCPNVLVGKSTVNGKTYHLGPQEIDEIRKLRLDNPQKYTRKFLAAKYGISPLFVSMVSKPSEQH
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

S
TTTS


S

S







TTTS
T





 .........150.........160.........170......
Sequence VQIMESRLQEIQSRWKEKRRIAREDRKRRKLLWYQA
Predicted secondary structure



SS confidence



































Known secondary structure (DSSP)

TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D