Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1vw4R_

Fold library idPDB HeaderMoleculeTitle
c1vw4R_PDB header: ribosomeChain: R: PDB Molecule: 54s ribosomal protein l2, mitochondrial;PDBTitle: structure of the yeast mitochondrial large ribosomal subunit


Added to library: Sat Apr 12 08:20:14 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SRTSMKDSAGRRLGPKKYEGQDVSTGEIIMRQRGTKFYPGENVGIGKDHSIFALEPGVVRYYLDPFHPKR
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)

S









SS
TT

TT

SS
S
TT
TT

SSS
TTSTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence KFIGVALRRDLKLPSPHFEPTVRRFGRFELTNKRAAYKEENSISRKDYLAKPNILKQLEVRESKRKELQD
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SSSSS
SS

SSS











S


T
 .........150.........160.........170.........180.........190.........200.........210
Sequence KLSKVLRDELKLDDIELATSYLIRVRASLKNGYPIEDARFNSRYYLKEEERLKARRESWTNEKLSESLSK
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) T



SS

T

 .........220.........230.........240.........250.........260.........270.........280
Sequence IDECSDLLNSSTSFNNKLELHQYISEQEKQALKAKLLEDLEKSQHLETKKDKNYIKALFKDACNFLTLSE
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
TTS



T



STTGGGGS
 .........290.........300.........310........
Sequence EVHLRRKYLKSVFPVSRRFDYTKVEVIARSRRAFLSKL
Predicted secondary structure













SS confidence





































Known secondary structure (DSSP) S
SS




S





TTTTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D