Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1vw4O_

Fold library idPDB HeaderMoleculeTitle
c1vw4O_PDB header: ribosomeChain: O: PDB Molecule: 54s ribosomal protein l22, mitochondrial;PDBTitle: structure of the yeast mitochondrial large ribosomal subunit


Added to library: Sat Apr 12 08:24:39 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ITIEDKLLQQHIISLQQPEQLASQSLLSPLKREIYEANCKINGGFYKKDTIVKLPNSSERYKLKLTKREI
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)




S

S

S
TTTS

SS


SSSS





 .........80.........90.........100.........110.........120.........130.........140
Sequence EVLEPSVYAQSYRIKSSMKKATLLLRLLGGLDVMKAISQCHFSNKKIAREVAELLQKGVKDGQKLGLKPE
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) S




BSS
GGGTT
B


T

GG
 .........150.........160.........170.........180.........190.........200.........210
Sequence DLYISQIWTGSDGFWRKRVEFKARTRIGIISHPYIHVRCILRTKSVTKRRLAYEAHLKEQKRAPWVQLGD
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) G
S


STT


TTTS



TT

 .........220...
Sequence KPIRGVTGGVYKW
Predicted secondary structure












SS confidence












Known secondary structure (DSSP)



S


SS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D