Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1vw4J_

Fold library idPDB HeaderMoleculeTitle
c1vw4J_PDB header: ribosomeChain: J: PDB Molecule: 54s ribosomal protein l10, mitochondrial;PDBTitle: structure of the yeast mitochondrial large ribosomal subunit


Added to library: Sat Apr 12 08:22:35 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VSILGQLKPSDGSTKSFKRLGRGPSSGLGKTSGRGQKGQKARGKVKSWFEGGQTPIYKLFPKIGFTNVGA
Predicted secondary structure





























































SS confidence





































































Known secondary structure (DSSP)

GGGG



TTS






SS
STTSS
TTTTS
SSSSTTSS


TT

TTS

S






SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence KPLKELNLKRIQWFHDKNRLHLQPGEVLDMNKMRKLGLVTGPIKYGVKILASGKFHYNLPIALEASRASA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)


T



SSSS
SSS
S

SS

SS
TT




S
 .........150.........160.........170.........180.........190.........200.........210
Sequence KAIAAIEKAGGKFTARYYTPLGLRAHLNPQWFLEKRGRVPLQARPTKRRDIDFYSKEEKRGYLVMEKDKL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT





SS







S
TTTTBTT
 .........220
Sequence LQDIKEAQNK
Predicted secondary structure

SS confidence









Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D