Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1vw4E_

Fold library idPDB HeaderMoleculeTitle
c1vw4E_PDB header: ribosomeChain: E: PDB Molecule: 54s ribosomal protein l7, mitochondrial;PDBTitle: structure of the yeast mitochondrial large ribosomal subunit


Added to library: Sat Apr 12 08:20:41 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PKSACSLVKPVHHLVKIDKSKLSPRFPELKYDKSDIRSPGFKPKDTHADRLNDHYLNTLQSDLLLINYSH
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)










S





GGGT

S
TTTTS
SSSTTSTT


S
SS

T

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence NAAVVKGLKQRAWSGDSPYHLNRPPKNPRGSKAQLPDIHPIKWSNIPGLESVVINCFVREARENQLLAIT
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) S


B




B



SSGGGTT


B

SS
SS



B



TTS




GGGGT
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence AALQLQQITGCKPHPIFSKNDVPTWKLRKGHQMGAKVELKGKEMSQFLSTLTEIVLPRIREYKGISNQSG
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) SS





BTTTTB
SS

TSTT




TT
B
 .........220.........230.........240.........250.........260.........270....
Sequence NRFGGISFGLTAEDIKFFPEIDANQDSWPKTFGMHININTSAQLDYQARTLLSGFQFPFFGEEK
Predicted secondary structure



































SS confidence































































Known secondary structure (DSSP)
SSS
TTGGGGSTTTTT
SS


S
SSTT


TT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D