Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1vw49_

Fold library idPDB HeaderMoleculeTitle
c1vw49_PDB header: ribosomeChain: 9: PDB Molecule: 54s ribosomal protein l15, mitochondrial;PDBTitle: structure of the yeast mitochondrial large ribosomal subunit


Added to library: Sat Apr 12 08:19:30 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VIYLHKGPRINGLRRDPESYLRNPSGVLFTEVKECQDKVRSILQLPKYGINLSNELILQCLTHKSFAHGS
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)





SS

SSS


SB
TT

BTTT

T
TTTT





TTGGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence KPYNEKLNLLGAQFLKLQTCIHSLKNLQFSNLGTKFAKELTSKNTACTFVKLHNLGPFIFWKMRDPIKGH
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) S






SSSSSST
GGG




SSS


G
 .........150.........160.........170.........180.........190.....
Sequence INGETTIFASVLNAFIGAILSTNGSEKAAKFIQGSLLDKEHSLVNIANENVASAK
Predicted secondary structure










SS confidence






















































Known secondary structure (DSSP) GGTS
ST
S




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D