Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1vw43_

Fold library idPDB HeaderMoleculeTitle
c1vw43_PDB header: ribosomeChain: 3: PDB Molecule: 54s ribosomal protein l27, mitochondrial;PDBTitle: structure of the yeast mitochondrial large ribosomal subunit


Added to library: Sat Apr 12 08:21:37 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LTRPWKKYRDGELFYGLSKVGNKRVPLTTKQGNKTMYKGTRASGIGRHTKFGGYVINWKKVRTYVTPDMV
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)

STT

S

S

SSSS
S




S


SSSS
SS




S


SS
SSS


GGG






SS
 .........80.........90.........100.........110.........120......
Sequence NFELKPYVNANVPPLKHEFKGGGPLDPRLQLLKIKEYIVNGRVQSEGATDSCYKER
Predicted secondary structure
































SS confidence























































Known secondary structure (DSSP)
TT

SS

TTS








TT
SSS

SS








Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D