Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1vw3C_

Fold library idPDB HeaderMoleculeTitle
c1vw3C_PDB header: ribosomeChain: C: PDB Molecule: 54s ribosomal protein l9, mitochondrial;PDBTitle: structure of the yeast mitochondrial large ribosomal subunit


Added to library: Sat Apr 12 08:27:20 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence STRPFLVAPSIANSITTEAPAINHSPELANARKWLPKRCGLITRKKGMMPYFDKSTGERSAATILEVNNV
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)







S








TTS



SS

TTT



S
 .........80.........90.........100.........110.........120.........130.........140
Sequence EVIMHRTSEVNGYFACQVGYGSRHLSKVSRQMLGHFASKVVNPKEHVAEFRVKDEKGLIPPGTLLKPSFF
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
SS


GGGS
TT



STGGG


TT

GGGS
 .........150.........160.........170.........180.........190.........200.........210
Sequence KEGQYVDVRSVSKGKGFTGVMKRYGFKGLRASHGTSIMHRHGGSYGQNQDPGRVLPGRKMPGHMGNEHVT
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)
TT





S





SSSS

S
TT




S
STTT
S

TT




SS
 .........220.........230.........240.........
Sequence IQNVKVLKVDDENNVIWVKGSVAGPKNSFVKIQDAIKKT
Predicted secondary structure



















SS confidence






































Known secondary structure (DSSP) TTTTS

SS
TT

STT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D