Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1vlbA_

Fold library idPDB HeaderMoleculeTitle
c1vlbA_PDB header: oxidoreductaseChain: A: PDB Molecule: aldehyde oxidoreductase;PDBTitle: structure refinement of the aldehyde oxidoreductase from2 desulfovibrio gigas at 1.28 a


Added to library: Tue Mar 16 12:09:05 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MIQKVITVNGIEQNLFVDAEALLSDVLRQQLGLTGVKVGCEQGQCGACSVILDGKVVRACVTKMKRVADG
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
TT
TTSBTT

TTS

SSSSSSS
TTTTGGG
BGGGS
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AQITTIEGVGQPENLHPLQKAWVLHGGAQCGFCSPGFIVSAKGLLDTNADPSREDVRDWFQKHRNACRCT
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)


BTTB

T

SS
TTTT
SS

TT


SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence GYKPLVDAVMDAAAVINGKKPETDLEFKMPADGRIWGSKYPRPTAVAKVTGTLDYGADLGLKMPAGTLHL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
STTSS
GGGGS



SS


TTS



TTTT
S

TS
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence AMVQAKVSHANIKGIDTSEALTMPGVHSVITHKDVKGKNRITGLITFPTNKGDGWDRPILCDEKVFQYGD
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
SSSS
TSTT
GGG

S
S

SS

TT
SS
S

SS
SS
STT
 .........290.........300.........310.........320.........330.........340.........350
Sequence CIALVCADSEANARAAAEKVKVDLEELPAYMSGPAAAAEDAIEIHPGTPNVYFEQPIVKGEDTGPIFASA
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) SSTT





SSTT


SSTTS
SSS

 .........360.........370.........380.........390.........400.........410.........420
Sequence DVTVEGDFYVGRQPHMPIEPDVAFAYMGDDGKCYIHSKSIGVHLHLYMIAPGVGLEPDQLVLVANPMGGT
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) S






SS


TTS
S
S
T

GGG


S

 .........430.........440.........450.........460.........470.........480.........490
Sequence FGYKFSPTSEALVAVAAMATGRPVHLRYNYQQQQQYTGKRSPWEMNVKFAAKKDGTLLAMESDWLVDHGP
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTGGGS
SSSS


SS
B



TT


TT
 .........500.........510.........520.........530.........540.........550.........560
Sequence YSEFGDLLTLRGAQFIGAGYNIPNIRGLGRTVATNHVWGSAFRGYGAPQSMFASECLMDMLAEKLGMDPL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

TTTTTTB




SS

B


TTTTT

 .........570.........580.........590.........600.........610.........620.........630
Sequence ELRYKNAYRPGDTNPTGQEPEVFSLPDMIDQLRPKYQAALEKAQKESTATHKKGVGISIGVYGSGLDGPD
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) B

TT


TTS


S




SSSSSTTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence ASEAWAELNADGTITVHTAWEDHGQGADIGCVGTAHEALRPMGVAPEKIKFTWPNTATTPNSGPSGGSRQ
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
TTS





SSS
GGGT

GGG


BTTTS




S
TT
 .........710.........720.........730.........740.........750.........760.........770
Sequence QVMTGNAIRVACENLLKACEKPGGGYYTYDELKAADKPTKITGNWTASGATHCDAVTGLGKPFVVYMYGV
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) B
TTSSB

TT



TT
B


TTT

SB

S
 .........780.........790.........800.........810.........820.........830.........840
Sequence FMAEVTVDVATGQTTVDGMTLMADLGSLCNQLATDGQIYGGLAQGIGLALSEDFEDIKKHATLVGAGFPF
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TTT


SS
S
T



STTTSSSTTTTT


 .........850.........860.........870.........880.........890.........900.......
Sequence IKQIPDKLDIVYVNHPRPDGPFGASGVGELPLTSPHAAIINAIKSATGVRIYRLPAYPEKVLEALKA
Predicted secondary structure
































SS confidence


































































Known secondary structure (DSSP) GGGS
S





TTSGGG



TTGGGSSS



BS




Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D