Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1u5mA_

Fold library idPDB HeaderMoleculeTitle
c1u5mA_PDB header: structural proteinChain: A: PDB Molecule: alpha 1 type ii collagen isoform 1;PDBTitle: structure of a chordin-like cysteine-rich repeat (vwc2 module) from collagen iia


Added to library: Wed Jan 9 20:12:38 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence YVEFQEAGSCVQDGQRYNDKDVWKPEPCRICVCDTGTVLCDDIICEDVKDCLSPEIPFGECCPICPADLA
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)

S



S
SSS

SS

S
SSTT


S

SS
S




SS
S

S

SSSS
 ...
Sequence AAA
Predicted secondary structure


SS confidence


Known secondary structure (DSSP)



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D