Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1qf6A_

Fold library idPDB HeaderMoleculeTitle
c1qf6A_PDB header: ligase/rnaChain: A: PDB Molecule: threonyl-trna synthetase;PDBTitle: structure of e. coli threonyl-trna synthetase complexed2 with its cognate trna


Added to library: Tue Mar 16 13:57:12 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PVITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGLEII
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

TTS

SS
B


STTTTS
B
S



TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence RHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVSW
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
TT




TT
SS


T
B

 .........150.........160.........170.........180.........190.........200.........210
Sequence HEARETFANRGESYKVSILDENIAHDDKPGLYFHEEYVDMCRGPHVPNMRFCHHFKLMKTAGAYWRGDSN
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) T
S
TT


TT

SS


SBGGG

SGGG
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence NKMLQRIYGTAWADKKALNAYLQRLEEAAKRDHRKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFV
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) S

SSTT
TT


TTSTT


 .........290.........300.........310.........320.........330.........340.........350
Sequence RSKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQGLKSYRDL
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TT




STSGGG
TT
SSSTTS
GGG
 .........360.........370.........380.........390.........400.........410.........420
Sequence PLRMAEFGSCHRNEPSGSLHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLS
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) S



GGG
BTTTB
S
GGGGGGT



 .........430.........440.........450.........460.........470.........480.........490
Sequence TRPEKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAWQCGTVQLDFSLPS
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)


SS

S
TTT


TT
S
TT


TT

SS
 .........500.........510.........520.........530.........540.........550.........560
Sequence RLSASYVGEDNERKVPVMIHRAILGSMERFIGILTEEFAGFFPTWLAPVQVVIMNITDSQSEYVNELTQK
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT


TTS


TT


TTT
SS
SS
 .........570.........580.........590.........600.........610.........620.........630
Sequence LSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQE
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTT



SS
TT
S
TTTGGG

SSS

 .........640.
Sequence IRSRSLKQLEE
Predicted secondary structure

SS confidence










Known secondary structure (DSSP) TT
SS
TT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D