Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1oqzB_

Fold library idPDB HeaderMoleculeTitle
c1oqzB_PDB header: hydrolaseChain: B: PDB Molecule: glutaryl acylase;PDBTitle: crystal structures of glutaryl 7-aminocephalosporanic acid2 acylase: insight into autoproteolytic activation


Added to library: Tue Mar 16 13:22:23 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PQAPIAAYKPRSNEILWDGYGVPHIYGVDAPSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQ
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)

S






SS
TTS

SSTT

GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence TTVWLLTNGVPERAQQWYAQQSPDFRANLDAFAAGINAYAQQNPDDISPDVRQVLPVSGADVVAHAHRLM
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTTS

GGGS
TT
S

 .........150.........160.........170.........180.........190.........200.........210
Sequence NFLYVASPGRTLGEGDPPDLADQGSNSWAVAPGKTANGNALLLQNPHLSWTTDYFTYYEAHLVTPDFEIY
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TTT

TTS





GGGBSSS

SS
GGG

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence GATQIGLPVIRFAFNQRMGITNTVNGMVGATNYRLTLQDGGYLYDGQVRPFERPQASYRLRQADGTTVDK
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT
SS
S
SS






TTTT

B


TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence PLEIRSSVHGPVFERADGTAVAVRVAGLDRPGMLEQYFDMITADSFDDYEAALARMQVPTFNIVYADREG
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

SSS
TTS
TTTT


T
SSTT

S
S
TTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence TINYSFNGVAPKRAEGDIAFWQGLVPGDSSRYLWTETHPLDDLPRVTNPPGGFVQNSNDPPWTPTWPVTY
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP)

S

B

SS

S
SS
GGG



B

GGGS
S
TTS
SSS
TT
SSSS
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence TPKDFPSYLAPQTPHSLRAQQSVRLMSENDDLTLERFMALQLSHRAVMADRTLPDLIPAALIDPDPEVQA
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
GGGS
TTSS





T

SB
T

B
TSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence AARLLAAWDREFTSDSRAALLFEEWARLFAGQNFAGQAGFATPWSLDKPVSTPYGVRDPKAAVDQLRTAI
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

SB

TT
SSS
TTS


TT
SB


TTSTTT
SBS
S
 .........570.........580.........590.........600.........610.........620.........630
Sequence ANTKRKYGAIDRPFGDASRMILNDVNVPGAAGYGNLGSFRVFTWSDPDENGVRTPVHGETWVAMIEFSTP
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) SSSS

BTT


B
GGGT
SSB



TTS
B



SS
 .........640.........650.........660.........670.........680......
Sequence VRAYGLMSYGNSRQPGTTHYSDQIERVSRADFRELLLRREQVEAAVQERTPFNFKP
Predicted secondary structure




























SS confidence























































Known secondary structure (DSSP)
TT
S

STT
SSSSSSTT




S





Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D