Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1oplA_

Fold library idPDB HeaderMoleculeTitle
c1oplA_PDB header: transferaseChain: A: PDB Molecule: proto-oncogene tyrosine-protein kinase;PDBTitle: structural basis for the auto-inhibition of c-abl tyrosine2 kinase


Added to library: Tue Mar 16 12:54:23 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGP
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)
TTSS
B


STTB

B
TT

TTSS
SS
GGGSSSGGGSTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence VSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHH
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

GGG

TT
SSSTT
TT

TTS
SSTTS
BSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence HSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVK
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) TT

TTSSS






S



SSS
SSSS

B

GGGSGGGTTSSGGGT
 .........220.........230.........240.........250.........260.........270.........280
Sequence TLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

SSSS



TTB


SSSS


TT
BS
TTTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence YMATQISSAMEYLEKKNFIHRNLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TT
S

SGGG
GGG


TT


TT



TT



GGG

 .........360.........370.........380.........390.........400.........410.........420
Sequence AYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPS
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

TTS

SSTT

TTTTT





TT

T
SSGG
 .........430.........440.........450.
Sequence DRPSFAEIHQAFETMFQESSISDEVEKELGK
Predicted secondary structure








SS confidence






























Known secondary structure (DSSP) GS

TS
SSS


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D