Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1ookG_

Fold library idPDB HeaderMoleculeTitle
c1ookG_PDB header: hydrolaseChain: G: PDB Molecule: platelet glycoprotein ib alpha chain precursor;PDBTitle: crystal structure of the complex of platelet receptor gpib-2 alpha and human alpha-thrombin


Added to library: Tue Mar 16 14:38:11 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTKL
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP)

SSTT
TTS

SS

S


TT
TTS

SGGGGSS
TT


TTS

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence QVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLP
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)

S

TT



SS

SS



TTT
TT



SS

SS

TTTTTT
TT


TTS





 .........150.........160.........170.........180.........190.........200.........210
Sequence PGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCN
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP) TTTTTT
TT



SS

S


TTTTSS
TT



SS





TTSSTT


S

SS
B

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence CEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLDYPEE
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) STTTGGGB




SSS
S
SS

GGG
BBTT
TT
BGGG



S
S
SSSSS








 ..
Sequence DT
Predicted secondary structure

SS confidence

Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D