Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1nyqA_

Fold library idPDB HeaderMoleculeTitle
c1nyqA_PDB header: ligaseChain: A: PDB Molecule: threonyl-trna synthetase 1;PDBTitle: structure of staphylococcus aureus threonyl-trna synthetase2 complexed with an analogue of threonyl adenylate


Added to library: Tue Mar 16 12:56:33 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEALEVL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)


SSS



SSB

TT

TSSSS

B
S

B
TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence RHSTAHLMAHAIKRLYGNVKFGVGPVIEGGFYYDFDIDQNISSDDFEQIEKTMKQIVNENMKIERKVVSR
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
SS






TT




SS


TTTT





 .........150.........160.........170.........180.........190.........200.........210
Sequence DEAKELFSNDEYKLELIDAIPEDENVTLYSQGDFTDLCRGVHVPSTAKIKEFKLLSTAGAYWRGDSNNKM
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

S



SSS



TT


S


S
GGG



B
STT
TTS

 .........220.........230.........240.........250.........260.........270.........280
Sequence LQRIYGTAFFDKKELKAHLQMLEERKERDHRKIGKELELFTNSQLVGAGLPLWLPNGATIRREIERYIVD
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) B

SS
TT


TTT
TT


 .........290.........300.........310.........320.........330.........340.........350
Sequence KEVSMGYDHVYTPVLANVDLYKTSGHWDHYQEDMFPPMQLDETESMVLRPMNCPHHMMIYANKPHSYREL
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT




STTSTTTTTTTS


B
STTS


S
STS

BTTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence PIRIAELGTMHRYEASGAVSGLQRVRGMTLNDSHIFVRPDQIKEEFKRVVNMIIDVYKDFGFEDYSFRLS
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) S



TTT
BTTTB
S
GGGTT



B

 .........430.........440.........450.........460.........470.........480.........490
Sequence YRDPEDKEKYFDDDDMWNKAENMLKEAADELGLSYEEAIGEAAFYGPKLDVQVKTAMGKEETLSTAQLDF
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

S


SSSS

T



T
SBTTB

TTS
S
 .........500.........510.........520.........530.........540.........550.........560
Sequence LLPERFDLTYIGQDGEHHRPVVIHRGVVSTMERFVAFLTEETKGAFPTWLAPKQVQIIPVNVDLHYDYAR
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) STT


SSS


TT


TTT
SS
SSTTTT
 .........570.........580.........590.........600.........610.........620.........630
Sequence QLQDELKSQGVRVSIDDRNEKMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEFIW
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTT




SS
TT
S
TSSSS

 .........640..
Sequence NLVDEIRLKKHR
Predicted secondary structure



SS confidence











Known secondary structure (DSSP) TT



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D