Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1m9sA_

Fold library idPDB HeaderMoleculeTitle
c1m9sA_PDB header: signaling proteinChain: A: PDB Molecule: internalin b;PDBTitle: crystal structure of internalin b (inlb), a listeria2 monocytogenes virulence protein containing sh3-like3 domains.


Added to library: Tue Mar 16 12:07:23 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ETITVSTPIKQIFPDDAFAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTKLFL
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)


SS


STT
S
TTS
TT



B
TT





TTGGG
TT


 .........80.........90.........100.........110.........120.........130.........140
Sequence NGNKLTDIKPLTNLKNLGWLFLDENKIKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNK
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP) TTS




GGGGG
TT



SS




TTSTT
TT


TTS




GGGGG
TT
S

SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence ITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFSQECLNK
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)



GGGGS
TT
S

SS




GGGTT
TT



SS


B
GGGTT
TT
S

S

 .........220.........230.........240.........250.........260.........270.........280
Sequence PINHQSNLVVPNTVKNTDGSLVTPEIISDDGDYEKPNVKWHLPEFTNEVSFIFYQPVTIGKAKARFHGRV
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)




SS



B
SSS
B


SSTT
TT


SS

STT
 .........290.........300.........310.........320.........330.........340.........350
Sequence TQPLETTEKTVNLTRYVKYIRGNAGIYKLPREDNSLKQGTLASHRCKALTVDREARNGGKLWYRLKNIGW
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)





S







STTTT
SSSS

GGGS
TTTTS


B




BTTB
BTTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence TKAENLSLDRYDKMEYDKGVTAYARVRNASGNSVWTKPYNTAGAKHVNKLSVYQGKNMRILREAKTPITT
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTTS
SS




S





S

TT
BSSSSSSTT


GGGG
SS




SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence WYQFSIGGKVIGWVDTRALNTFYKQSMEKPTRLTRYVSANKAGESYYKVPVADNPVKRGTLAKYKNQKLI
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTTTTGGG

TTTTTSSSSS

GGGGGGSTT

 .........500.........510.........520...
Sequence VDCQATIEGQLWYRIRTSSTFIGWTKAANLRAQ
Predicted secondary structure










SS confidence
































Known secondary structure (DSSP) TT
SSSGGG


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D