Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1ltxA_

Fold library idPDB HeaderMoleculeTitle
c1ltxA_PDB header: transferase/protein bindingChain: A: PDB Molecule: rab geranylgeranyltransferase alpha subunit;PDBTitle: structure of rab escort protein-1 in complex with rab2 geranylgeranyl transferase and isoprenoid


Added to library: Tue Mar 16 14:41:10 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KLKLYQSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRREVLQHLETEKSPEESAALVKAEL
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)



TS


SSTT
TT
GGGSSSSS
TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GFLESCLRVNPKSYGTWHHRCWLLSRLPEPNWARELELCARFLEADERNFHCWDYRRFVAAQAAVAPAEE
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)
S


SS
T
TT
TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence LAFTDSLITRNFSNYSSWHYRSCLLPQLHPQGRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGRA
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)
SS
TTTT



SS
T
TT
TT


 .........220.........230.........240.........250.........260.........270.........280
Sequence EPVLCCVHVSREEACLSVCFSRPLTVGSRMGTLLLMVDEAPLSVEWRTPDGRNRPSHVWLCDLPAASLND
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP)


TTTT
SSBTTB
SSSB




B
TTSS

S

GGGTSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence QLPQHTFRVIWTGSDSQKECVLLKDRPECWCRDSATDEQLFRCELSVEKSTVLQSELESCKELQELEPEN
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) SSSTTT

TT
S

TTTTTSS




STT
 .........360.........370.........380.........390.........400.........410.........420
Sequence KWCLLTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLENSVLKMEYADVRVLHLAHK
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)
TTTT
GGGT
S

SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence DLTVLCHLEQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALENVDGVANLPRLQELLLCNNRLQ
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP)


S


GGG
TT



SS


B

GGGGG
TT



SS


B
GGGSS
TT



SS


 .........500.........510.........520.........530......
Sequence QSAAIQPLVSCPRLVLLNLQGNSLCQEEGIQERLAEMLPSVSSILT
Predicted secondary structure




























SS confidence













































Known secondary structure (DSSP) SGGGGGGGGG
TT


TTSGGGGSTT
TT
SB



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D