Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c1kyqC_

Fold library idPDB HeaderMoleculeTitle
c1kyqC_PDB header: oxidoreductase, lyaseChain: C: PDB Molecule: siroheme biosynthesis protein met8;PDBTitle: met8p: a bifunctional nad-dependent dehydrogenase and2 ferrochelatase involved in siroheme synthesis.


Added to library: Tue Mar 16 12:04:12 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XVKSLQLAHQLKDKRILLIGGGEVGLTRLYKLXPTGCKLTLVSPDLHKSIIPKFGKFIQKRFINPNWDPT
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)










TT
SGGGT

TT
GGG


TT

GG
 .........80.........90.........100.........110.........120.........130.........140
Sequence KNEIYEYIRSDFKDEYLDLENENDAWYIIXTCIPDHPESARIYHLCKERFGKQQLVNVADKPDLCDFYFG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) G


S
SS

GGGG

SSTT



S

TTSTT
GGGBS



 .........150.........160.........170.........180.........190.........200.........210
Sequence ANLEIGDRLQILISTNGLSPRFGALVRDEIRNLFTQXGDLALEDAVVKLGELRRGIRLLAPDDKDVKYRX
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTT

SSS
T



TTS
STTS
 .........220.........230.........240.........250.........260..
Sequence DWARRCTDLFGIQHCHNIDVKRLLDLFKVXFQEQNCSLQFPPRERLLSEYCS
Predicted secondary structure


















SS confidence



















































Known secondary structure (DSSP) GGGB
TTTS





SB


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D